Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Cobalamin synthase (cobS)

This Recombinant Halobacterium salinarum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q9HPL2

Expression Region

1-199

Origin

Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAGGVPHGTVAFAYLAVVFAVTGINHLDGVADAGDAAVVHGDPADRRTVLKDTTTGVGA IAAVVVVVAGLVTGSLGVAALPTWTAVGVVVATEVGAKTSMAAVACLAHAPHDGLGSQFT GNATPGALPAVAGVALPVALASVPSPAAAGALAGAVGAGALTRRWLTGLLGGANGDVFGA VNEVSRVVGLHAGVVVWTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rassf8-set siRNA/shRNA/RNAi Lentivector (Mouse)
38560094 4x 500 ng

Rassf8-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Recombinant Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC)
TRV-0010799-01 10 µg

Recombinant Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC)

Sign In for Pricing
View Details
Recombinant Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC)
TRV-0010799-02 50 µg

Recombinant Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC)

Sign In for Pricing
View Details
Recombinant Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC)
TRV-0010799-03 100 µg

Recombinant Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC)

Sign In for Pricing
View Details
Recombinant Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC)
TRV-0010799-04 200 µg

Recombinant Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC)

Sign In for Pricing
View Details
Recombinant Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC)
TRV-0010799-05 500 µg

Recombinant Protein Kinase, DNA Activated, Catalytic Polypeptide (PRKDC)

Sign In for Pricing
View Details