Recombinant Drosophila melanogaster Signal peptidase complex subunit 2 (Spase25)
This Recombinant Drosophila melanogaster Signal peptidase complex subunit 2 (Spase25) spans the amino acid sequence from region 1-199.
Product Specifications
Product Name Alternative
Signal peptidase complex subunit 2, EC= 3.4.-.-, Microsomal signal peptidase 25 kDa subunit, SPase 25 kDa subunit
UniProt
Q9VYY2
Expression Region
1-199
Origin
Drosophila melanogaster (Fruit fly)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGKKDEKSQQGEELVKVNKWDGSAVKHALDDAVKTCLLGDRPQLKEQFGLVNTRLALCAL AVSVAIMAHAWDFTHPFPESRPVLLFSVLAYFALLGILTLHSSFREKGTFAVALQKDKER ERLWEASSDMRKYDDKYLLTLSVRDTKNGKRREQSSNKSCAAFIDQNGIVLDNLVANEVN RLFNALAADKKNASSLSSN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680354-500 1x 500 µL
AFP (Alpha Fetoprotein) (C3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041138-100 1x 100 µL
WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400294-500 1x 500 µL
NKX2.2 (NX2/294), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741543-500 1x 500 µL
Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details