Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Casuarius bennetti Cytochrome c oxidase subunit 2 (MT-CO2)

This Recombinant Casuarius bennetti Cytochrome c oxidase subunit 2 (MT-CO2) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

O03890

Expression Region

1-199

Origin

Casuarius bennetti (Dwarf cassowary)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AICSLVLYLLTLMLMEKLSSNTVDAQEVELIWTILPAIVLILLALPSLQILYMMDEIDEP DLTLKAIGHQWYWTYEYTDFKDLSFDSYMVPTSELPSGHFRLLEVDHRVVVPMESPIRVI ITAGDVLHSWAVPTLGVKTDAIPGRLNQTSFITTRPGIFYGQCSEICGANHSYMPIVVES TPLTHFENWSSLLSISSSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-100 1x 100 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
BNC880965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-500 1x 500 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details