Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine arteritis virus Glycoprotein 2b (GP2b)

This Recombinant Equine arteritis virus Glycoprotein 2b (GP2b) spans the amino acid sequence from region 29-227.

Product Specifications

Product Name Alternative

Glycoprotein 2b, Protein GP2b, GP (S)

UniProt

P28992

Expression Region

29-227

Origin

Equine arteritis virus (strain Bucyrus) (EAV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AWWRGVHEVRVTDLFKDLQCDNLRAKDAFPSLGYALSIGQSRLSYMLQDWLLAAHRKEVM PSNIMPMPGLTPDCFDHLESSSYAPFINAYRQAILSQYPQELQLEAINCKLLAVVAPALY HNYHLANLTGPATWVVPTVGQLHYYASSSIFASSVEVLAAIILLFACIPLVTRVYISFTR LMSPSRRTSSGTLPRRKIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS701849 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
DRP2 Human Gene Knockout Kit (CRISPR)
KN415641 1 Kit

DRP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MRPS33 activation kit by CRISPRa
GA109922 1 Kit

Human MRPS33 activation kit by CRISPRa

Sign In for Pricing
View Details
CD43 (DF-T1), CF647 conjugate, 0.1mg/mL
BNC470027-500 1x 500 µL

CD43 (DF-T1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKG2A (KLRC1) Human Gene Knockout Kit (CRISPR)
KN203062 1 Kit

NKG2A (KLRC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Stathmin 1 (STMN1) Rabbit Polyclonal Antibody
AP20715PU-N 100 µg

Stathmin 1 (STMN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details