Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus clavatus Protein get1 (get1)

This Recombinant Aspergillus clavatus Protein get1 (get1) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

Protein get1, Guided entry of tail-anchored proteins 1

UniProt

A1CGU5

Expression Region

1-200

Origin

Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSLILTIFFVHVAIYLVNTAGASTIDTALWALYLKLPTSTAKNAREQSRLKREVVQLNR EMNNTSSQDEFAKWAKLRRRHDKAKDEYETINQALTSQKTSFDWAVKIARWLSTSGLKIF LQFYYSKTPVFALPAGWFPSIVEWMLSFPRAPRGSVSVQVWNSVCATAIAVMAEIFAAML VRMRGQAAARTPAAKAQKTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF488A conjugate, 0.1mg/mL
BNC880416-100 1x 100 µL

Fascin-1 (FSCN1/416), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX7 (PAX7/497), CF568 conjugate, 0.1mg/mL
BNC680497-500 1x 500 µL

PAX7 (PAX7/497), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details