Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0316 protein SAHV_1896 (SAHV_1896)

This Recombinant Staphylococcus aureus UPF0316 protein SAHV_1896 (SAHV_1896) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

UPF0316 protein SAHV_1896

UniProt

A7X441

Expression Region

1-200

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-100 1x 100 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-500 1x 500 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), CF405S conjugate, 0.1mg/mL
BNC042220-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/839), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL
BNC940948-500 1x 500 µL

Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details