Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium populi ATP synthase subunit b/b' (atpG)

This Recombinant Methylobacterium populi ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'

UniProt

B1ZJN3

Expression Region

1-200

Origin

Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQNILTTPSPNADTTIVPPGSPHTHTEQPSGGHGGAFPPFESHTFLAQLIWLALAFGL LYYLMSKVALPRIEAILGDRAGRLSSDLNEAQRMKAEADAAGAAYETSLREAQAKAQAIA QETRNSLSAEADAKRKTLEAELNQRLAASEATIRARTSEAMGNVRTIAGETASAIVERLT GQAPDQASLNRALDATPAVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS622328 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
5-Hydroxypyrazine-2-carboxylic Acid
TRC-H952675-5G 5 g

5-Hydroxypyrazine-2-carboxylic Acid

Sign In for Pricing
View Details
Human TRIM49D1 activation kit by CRISPRa
GA118256 1 Kit

Human TRIM49D1 activation kit by CRISPRa

Sign In for Pricing
View Details
NUP98 Rabbit Monoclonal Antibody
TA422494 100 µL

NUP98 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ELK1 pSer389 Rabbit Polyclonal Antibody
AP01578PU-N 100 µg

ELK1 pSer389 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTGF Polyclonal Antibody
E-AB-70032-01 60 µL

CTGF Polyclonal Antibody

Sign In for Pricing
View Details