Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium populi ATP synthase subunit b/b' (atpG)

This Recombinant Methylobacterium populi ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'

UniProt

B1ZJN3

Expression Region

1-200

Origin

Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQNILTTPSPNADTTIVPPGSPHTHTEQPSGGHGGAFPPFESHTFLAQLIWLALAFGL LYYLMSKVALPRIEAILGDRAGRLSSDLNEAQRMKAEADAAGAAYETSLREAQAKAQAIA QETRNSLSAEADAKRKTLEAELNQRLAASEATIRARTSEAMGNVRTIAGETASAIVERLT GQAPDQASLNRALDATPAVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carminic Acid, >70%
TRC-C183620-5G 5 g

Carminic Acid, >70%

Sign In for Pricing
View Details
TGF beta 1 (TGFB1) (286-293) Rabbit Polyclonal Antibody
AP07828PU-N 50 µg

TGF beta 1 (TGFB1) (286-293) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FGFR3 (NM_000142) Human Over-expression Lysate
LC424902 20 µg

FGFR3 (NM_000142) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant GRASP65 Antibody
RC-16680-01 50 μL

Recombinant GRASP65 Antibody

Sign In for Pricing
View Details
Recombinant GRASP65 Antibody
RC-16680-02 100 µL

Recombinant GRASP65 Antibody

Sign In for Pricing
View Details
Recombinant GRASP65 Antibody
RC-16680-03 1 mL

Recombinant GRASP65 Antibody

Sign In for Pricing
View Details