Recombinant Neosartorya fumigata Protein get1 (get1)
This Recombinant Neosartorya fumigata Protein get1 (get1) spans the amino acid sequence from region 1-200.
Product Specifications
Product Name Alternative
Protein get1, Guided entry of tail-anchored proteins 1
UniProt
B0Y5H9
Expression Region
1-200
Origin
Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTSRNARQQSRLKREVVQLKR EMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDWSVKIARWLSTNGLKIF LQFYYSKTPVFALPAGWFPFYVEWVLSFPRAPRGSVSVQVWNSVCATAIAVMAEIVTSML LQLRSRSASPASTAKAQKAQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401870-100 1x 100 µL
CD10 (Membrane Metalloendopeptidase) (MME/1870), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402984-500 1x 500 µL
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details