Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trypsin-2 (PRSS2)

Product Specifications

Product Name Alternative

Anionic trypsinogen; Serine protease 2; Trypsin II

Abbreviation

Recombinant Human PRSS2 protein

Gene Name

PRSS2

UniProt

P07478

Expression Region

24-247aa

Organism

Homo sapiens (Human)

Target Sequence

IVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

In the ileum, may be involved in defensin processing, including DEFA5.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.0 kDa

References & Citations

"Paneth cell trypsin is the processing enzyme for human defensin-5." Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L. Nat. Immunol. 3:583-590 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pigyl activation kit by CRISPRa
GA206676 1 Kit

Mouse Pigyl activation kit by CRISPRa

Sign In for Pricing
View Details
ZNHIT1 Rabbit Polyclonal Antibody
TA369499 100 µL

ZNHIT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS632424 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
FXYD1 Polyclonal Antibody
E-AB-10954-01 20 µL

FXYD1 Polyclonal Antibody

Sign In for Pricing
View Details
FXYD1 Polyclonal Antibody
E-AB-10954-02 60 µL

FXYD1 Polyclonal Antibody

Sign In for Pricing
View Details
FXYD1 Polyclonal Antibody
E-AB-10954-03 120 µL

FXYD1 Polyclonal Antibody

Sign In for Pricing
View Details