Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neosartorya fumigata Protein get1 (get1)

This Recombinant Neosartorya fumigata Protein get1 (get1) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

Protein get1, Guided entry of tail-anchored proteins 1

UniProt

Q4WNN2

Expression Region

1-200

Origin

Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTSRNARQQSRLKREVVQLKR EMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDWSVKIARWLSTNGLKIF LQFYYSKTPVFALPAGWFPFYVEWVLSFPRAPRGSVSVQVWNSVCATAIAVMAEIVTSML LQLRSRSASPASTAKAQKAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-500 1x 500 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-500 1x 500 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL
BNC740523-500 1x 500 µL

AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF488A conjugate, 0.1mg/mL
BNC881846-100 1x 100 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF647 conjugate, 0.1mg/mL
BNC472883-500 1x 500 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF488A conjugate, 0.1mg/mL
BNC880634-500 1x 500 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details