Recombinant Staphylococcus aureus UPF0316 protein SAS1835 (SAS1835)
This Recombinant Staphylococcus aureus UPF0316 protein SAS1835 (SAS1835) spans the amino acid sequence from region 1-200.
Product Specifications
Product Name Alternative
UPF0316 protein SAS1835
UniProt
Q6G821
Expression Region
1-200
Origin
Staphylococcus aureus (strain MSSA476)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSFVTENPWLMVLTIFIINVCYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681461-100 1x 100 µL
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402076-100 1x 100 µL
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details