Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-21 (tim-21)

This Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-21 (tim-21) spans the amino acid sequence from region 52-251.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit tim-21

UniProt

Q7S8S5

Expression Region

52-251

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATTQESSKRRSVTPFNDDGHVPWTRLSTGEKAGRAVQQTFNFGLVILGVVLTGGIAYLLF TDVFSPESKTAYFNRAVDRIRADPRCVALLSPGDPKKIAAHGEETHNKWRRARPIAATVE KDNRGVEHLKMHFHVEGPRGSGVVGLHLTKQPGHWEHEYQTFYVDVRGHQRIYLENKEAE VAAAKKGGNKEFKFLGVKWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF180 Human Gene Knockout Kit (CRISPR)
KN417473 1 Kit

ZNF180 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WDFY3 Antibody
SPC-666S 12 µg

WDFY3 Antibody

Sign In for Pricing
View Details
Snx8 Mouse Gene Knockout Kit (CRISPR)
KN516449 1 Kit

Snx8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Borane Ammonia Complex
TRC-B675275-2.5G 2.5 g

Borane Ammonia Complex

Sign In for Pricing
View Details
KIAA0513 Antibody
KC-39880-01 50 μL

KIAA0513 Antibody

Sign In for Pricing
View Details
KIAA0513 Antibody
KC-39880-02 100 µL

KIAA0513 Antibody

Sign In for Pricing
View Details