Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mpv17-like protein 2 (Mpv17l2)

This Recombinant Mouse Mpv17-like protein 2 (Mpv17l2) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

Mpv17-like protein 2

UniProt

Q8VIK2

Expression Region

1-200

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALGGWRWARKALAAGRPLFQGRALLLTNTLGCGVLMAAGDGARQVWEVRARPGQRFSAR RSASMFAVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLVDQTVASPILGVWYFLG LGSLEGQTLEESCQELRAKFWDFYKADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDT YLSYLKYWVPEPLQTPGCAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lypd2 (NM_026671) Mouse Tagged ORF Clone
MG200676 10 µg

Lypd2 (NM_026671) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
XYLT1 Human Gene Knockout Kit (CRISPR)
KN422133 1 Kit

XYLT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF217 Mouse Monoclonal Antibody [Clone ID: OTI1B10]
CF809020 100 µg

ZNF217 Mouse Monoclonal Antibody [Clone ID: OTI1B10]

Sign In for Pricing
View Details
SOX10 (SOX10/991), 0.2mg/mL
BNUB0991-100 1x 100 µL

SOX10 (SOX10/991), 0.2mg/mL

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD19 Antibody[4G7]
E-AB-F1127P-01 20 Tests

PE/Elab Fluor® 594 Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Human CD19 Antibody[4G7]
E-AB-F1127P-02 100 Tests

PE/Elab Fluor® 594 Anti-Human CD19 Antibody[4G7]

Sign In for Pricing
View Details