Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q9BBR9

Expression Region

1-200

Origin

Lotus japonicus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTWISEDTWQSEEVRVDFVTGCRNPRDFFWAFITLLGSVGFLLVAASSYLHKNFLSFISS EFDSELIRFLPQGATITVYGTAGLFVSLFLWLTIFWNVGSGYDLFDKKRGIVCIFRYGFP GKNRRIFIRVLINDIQSLIIQSKKENKKEGRYLRSGVLYMQTREQGAIPLTAVDDSWNPP KIAQKAGDLSKLLRVPIEIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 3,3-Difluoro-2-hydroxycyclopent-1-ene Carboxylate
TRC-E430060-500MG 500 mg

Ethyl 3,3-Difluoro-2-hydroxycyclopent-1-ene Carboxylate

Sign In for Pricing
View Details
FAM161A (NM_032180) Human Recombinant Protein
TP315140M 100 µg

FAM161A (NM_032180) Human Recombinant Protein

Sign In for Pricing
View Details
IRF5 (NM_001098629) Human Over-expression Lysate
LC420652 20 µg

IRF5 (NM_001098629) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit
RDR-PIICP-Hu-01 96 Tests

Human Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit

Sign In for Pricing
View Details
Human Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit
RDR-PIICP-Hu-02 48 Tests

Human Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit

Sign In for Pricing
View Details
3,4-Diethylpyrrole
TRC-D492978-50MG 50 mg

3,4-Diethylpyrrole

Sign In for Pricing
View Details