Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized membrane protein YuaF (yuaF)

This Recombinant Escherichia coli Uncharacterized membrane protein YuaF (yuaF) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein YuaF

UniProt

Q9JMT4

Expression Region

1-200

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCINTDCTYTKIAIEQLLHEKYFDDRRYCHSIKIYDLRFFKIEDVAYKLIQLFKERRKE NIIFLCSDRFIHSKEKPRNIFFLDTKDSIRNWSRHLKKLRYCNSNLLICFLFLCGLYHIS VFTGKKQVIIACIKKGFSFAEIVNFLNINARTLVNYLGGLTTYFILPYSDSLYKYIIDNI IASSTEEYHILLTNQRRYYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TOR1AIP1 siRNA
abx905736-01 15 nmol

Human TOR1AIP1 siRNA

Sign In for Pricing
View Details
Human TOR1AIP1 siRNA
abx905736-02 30 nmol

Human TOR1AIP1 siRNA

Sign In for Pricing
View Details
1H-Thieno[3,4-d]pyrimidine-2,4-dione
sc-475261 500 mg

1H-Thieno[3,4-d]pyrimidine-2,4-dione

Sign In for Pricing
View Details
COPA Protein Vector (Rat) (pPM-C-His)
PV261189 500 ng

COPA Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
GOLGA6L1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2772405 3x 1.0 µg

GOLGA6L1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (MaxLight 405) discontinued
246907-ML405 100 µL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (MaxLight 405) discontinued

Sign In for Pricing
View Details