Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter lovleyi ATP synthase subunit b (atpF)

This Recombinant Geobacter lovleyi ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B3EA05

Expression Region

1-200

Origin

Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIQNDRRMQRILSGLAVAVAILVPVLALASGGGEHHPDSGAQLKDFGWRVVDFALLAGI MIWALKKANVKGSLAERQLQIEKNLREAREARETAEAKLKEYTEKLEKANQEVDTLRAAM LKEAEAEKQRIVAEAQAAAAKVTEQAAQAADQEVLKARTELRVEAARLAVELAGGKLGAA VQKADHDRFVQDYLGKVVQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR89A siRNA (Human)
MBS8211065-01 15 nmol

GPR89A siRNA (Human)

Sign In for Pricing
View Details
GPR89A siRNA (Human)
MBS8211065-02 30 nmol

GPR89A siRNA (Human)

Sign In for Pricing
View Details
GPR89A siRNA (Human)
MBS8211065-03 5x 30 nmol

GPR89A siRNA (Human)

Sign In for Pricing
View Details
ZNF274 CRISPR All-in-one AAV vector set (with saCas9)(Human)
51401151 3x 1.0 µg DNA

ZNF274 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
TH AAV Vector (Rat) (CMV)
46622106 1 µg

TH AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
4 Aminophenyl phosphoryl choline (4APPC) -BSA
900103BA 1 mg

4 Aminophenyl phosphoryl choline (4APPC) -BSA

Sign In for Pricing
View Details