Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter lovleyi ATP synthase subunit b (atpF)

This Recombinant Geobacter lovleyi ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-200.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B3EA05

Expression Region

1-200

Origin

Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIQNDRRMQRILSGLAVAVAILVPVLALASGGGEHHPDSGAQLKDFGWRVVDFALLAGI MIWALKKANVKGSLAERQLQIEKNLREAREARETAEAKLKEYTEKLEKANQEVDTLRAAM LKEAEAEKQRIVAEAQAAAAKVTEQAAQAADQEVLKARTELRVEAARLAVELAGGKLGAA VQKADHDRFVQDYLGKVVQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen VI (COL6A1) Human Over-expression Lysate
orb1365051 20 µg

Collagen VI (COL6A1) Human Over-expression Lysate

Sign In for Pricing
View Details
Pcdhb4 AAV siRNA Pooled Vector
36156164 1.0 µg

Pcdhb4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
J4000-EU Desktop Printers & Kits
152711 1 Box (1 Piece (s) x 1 Box)

J4000-EU Desktop Printers & Kits

Sign In for Pricing
View Details
Rabgef1 3'UTR GFP Stable Cell Line
TU267234 1.0 mL

Rabgef1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Anti-Human HLA-DRB1 pAb
PA15927-01 50 μL

Rabbit Anti-Human HLA-DRB1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human HLA-DRB1 pAb
PA15927-02 100 μL

Rabbit Anti-Human HLA-DRB1 pAb

Sign In for Pricing
View Details