Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative lipoprotein lprH (lprH)

This Recombinant Putative lipoprotein lprH (lprH) spans the amino acid sequence from region 28-228.

Product Specifications

Product Name Alternative

Putative lipoprotein lprH

UniProt

P65316

Expression Region

28-228

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CTESVAGRAMRATDRSSGLPTSAKPARARDLLLQDGDRAPFGQVTQSRVGDSYFTSAVPP ECSAALLFKGSPLRPDGSSDHAEAAYNVTGPLPYAESVDVYTNVLNVHDVVWNGFRDVSH CRGDAVGVSRAGRSTPMRLRYFATLSDGVLVWTMSNPRWTCDYGLAVVPHAVLVLSACGF KPGFPMAEWASKRRAQLDSQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppil1 (BC058369) Mouse Tagged ORF Clone
MG201351 10 µg

Ppil1 (BC058369) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PD-L1 Recombinant Rabbit Monoclonal Antibody [PSH08-56]
HA723002 100 µL

PD-L1 Recombinant Rabbit Monoclonal Antibody [PSH08-56]

Sign In for Pricing
View Details
EIF4E Antibody (Biotin)
KB-7904-01 50 μL

EIF4E Antibody (Biotin)

Sign In for Pricing
View Details
EIF4E Antibody (Biotin)
KB-7904-02 100 µL

EIF4E Antibody (Biotin)

Sign In for Pricing
View Details
EIF4E Antibody (Biotin)
KB-7904-03 1 mL

EIF4E Antibody (Biotin)

Sign In for Pricing
View Details
CKII alpha (CSNK2A1) pThr360/pSer362 Rabbit Polyclonal Antibody
AP26043PU-N 100 µL

CKII alpha (CSNK2A1) pThr360/pSer362 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details