Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium extorquens ATP synthase subunit b/b' (atpG)

This Recombinant Methylobacterium extorquens ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'

UniProt

A9VYW8

Expression Region

1-201

Origin

Methylobacterium extorquens (strain PA1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQKNPLTTPSPNADTTIVPAGSPHTHTEQPSGGHGGAFPPFESHTFLSQLIWLALAFG LLYYLMSKVALPRIEAILGNRAGRLSSDLTEAQRMKTEADAAGAAYEKSLREAQAKAQAI AQETRNSLSAEADAKRKTLEAELNQRLAASEATIRTRTTEAMGNVRAIAGETASAIVERL TGQAPDQASLNRALDATPAVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Succinimidyl Nervonate
TRC-S690950-25MG 25 mg

Succinimidyl Nervonate

Sign In for Pricing
View Details
Frozen Tissue Sections, Brain
CS644524 5x 5 µm

Frozen Tissue Sections, Brain

Sign In for Pricing
View Details
Recombinant Mouse CXCL10 protein (His Tag)
PKSM041503-01 20 µg

Recombinant Mouse CXCL10 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CXCL10 protein (His Tag)
PKSM041503-02 100 µg

Recombinant Mouse CXCL10 protein (His Tag)

Sign In for Pricing
View Details
20(S)-Ginsenoside Rh1
TRC-G410175-50MG 50 mg

20(S)-Ginsenoside Rh1

Sign In for Pricing
View Details
GABRA2 (NM_001114175) Human Over-expression Lysate
LC426471 20 µg

GABRA2 (NM_001114175) Human Over-expression Lysate

Sign In for Pricing
View Details