Recombinant Methylobacterium extorquens ATP synthase subunit b/b' (atpG)
This Recombinant Methylobacterium extorquens ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-201.
Product Specifications
Product Name Alternative
ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'
UniProt
A9VYW8
Expression Region
1-201
Origin
Methylobacterium extorquens (strain PA1)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAEQKNPLTTPSPNADTTIVPAGSPHTHTEQPSGGHGGAFPPFESHTFLSQLIWLALAFG LLYYLMSKVALPRIEAILGNRAGRLSSDLTEAQRMKTEADAAGAAYEKSLREAQAKAQAI AQETRNSLSAEADAKRKTLEAELNQRLAASEATIRTRTTEAMGNVRAIAGETASAIVERL TGQAPDQASLNRALDATPAVH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC400202 20 µg
Alpha 1 Acid Glycoprotein (ORM1) (NM_000607) Human Over-expression Lysate
Sign In for Pricing
View Details 
LY419655 100 µg
Decorin (DCN) (NM_001920) Human Over-expression Lysate
Sign In for Pricing
View Details 
E-UNEL-H0203-01 5x 96 Tests
Uncoated Human SP-D (Pulmonary surfactant-associated protein D) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0203-02 15x 96 Tests
Uncoated Human SP-D (Pulmonary surfactant-associated protein D) ELISA Kit
Sign In for Pricing
View Details 