Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium nodulans Potassium-transporting ATPase C chain (kdpC)

This Recombinant Methylobacterium nodulans Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

B8I9I8

Expression Region

1-201

Origin

Methylobacterium nodulans (strain ORS2060 / LMG 21967)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQHLRPTLVLGVALTLLTGLAYPLAMTGLAGILFPVEAAGSLVERDGKVVGSRLIGQSF TGDRFFHGRPSATTAPDPTDASKTMPAPYNAANSGGSNLGPTSAALADRVKADVERLRAE NPGAPVPVDLVTTSGSGLDPDISPEAALFQVPRIAKARHLPEERLRDLVAAQVQGRTLGL IGEPRVNVLALNLALDELAGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cinnoline-4-carboxylic acid
OR962973-01 250 mg

Cinnoline-4-carboxylic acid

Sign In for Pricing
View Details
Cinnoline-4-carboxylic acid
OR962973-02 1 g

Cinnoline-4-carboxylic acid

Sign In for Pricing
View Details
RGR Antibody - N-terminal region : FITC (ARP63387_P050-FITC)
ARP63387_P050-FITC 100 µL

RGR Antibody - N-terminal region : FITC (ARP63387_P050-FITC)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein GLI2 (GLI2), partial
MBS9423586-01 0.02 mg

Recombinant Human Zinc finger protein GLI2 (GLI2), partial

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein GLI2 (GLI2), partial
MBS9423586-02 0.1 mg

Recombinant Human Zinc finger protein GLI2 (GLI2), partial

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein GLI2 (GLI2), partial
MBS9423586-03 1 mg

Recombinant Human Zinc finger protein GLI2 (GLI2), partial

Sign In for Pricing
View Details