Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Receptor expression-enhancing protein 6 (Reep6)

This Recombinant Mouse Receptor expression-enhancing protein 6 (Reep6) spans the amino acid sequence from region 1-201.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 6, Polyposis locus protein 1-like 1, TB2 protein-like 1

UniProt

Q9JM62

Expression Region

1-201

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGLRQRFERFLEQKNVATEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNV IGFVYPAYASVKAIESPSKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFL LFCMTPGPWNGALLLYHRVIRPLFLKHHMALDSAASQLSGRALDLAAGITRDVLQALARG RALVTPASTSEPPAALELDPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TRUB1 activation kit by CRISPRa
GA115447 1 Kit

Human TRUB1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human HNRNPUL2 activation kit by CRISPRa
GA116593 1 Kit

Human HNRNPUL2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human MIER3 activation kit by CRISPRa
GA116151 1 Kit

Human MIER3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human OR6J1 activation kit by CRISPRa
GA112457 1 Kit

Human OR6J1 activation kit by CRISPRa

Sign In for Pricing
View Details
DAXX (NM_001350) Human Recombinant Protein
TP319497M 100 µg

DAXX (NM_001350) Human Recombinant Protein

Sign In for Pricing
View Details
AMPK beta 1 Antibody (PRKAB1)
F50060-0.4ML 0.4 mL

AMPK beta 1 Antibody (PRKAB1)

Sign In for Pricing
View Details