Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 6A, chloroplastic (CAB6A)

This Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 6A, chloroplastic (CAB6A) spans the amino acid sequence from region 46-246.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 6A, chloroplastic, LHCI type I CAB-6A, Light-harvesting complex I 26 kDa protein

UniProt

P12360

Expression Region

46-246

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SADWMPGQPRPSYLDGSAPGDFGFDSLGLGEVPANLERYKESELIHCRWAMLAVPGIIVP EALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQRSMEKDSEK KKYPGGAFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATH LADPWHNNIGDVIIPKGIFPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha 2 Antiplasmin (SERPINF2) (NM_001165921) Human Over-expression Lysate
LC431370 20 µg

Alpha 2 Antiplasmin (SERPINF2) (NM_001165921) Human Over-expression Lysate

Sign In for Pricing
View Details
P57 / KIP2 (KP10), Biotin conjugate, 0.1mg/mL
BNCB0879-100 1x 100 µL

P57 / KIP2 (KP10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SFTPA1 (NM_001164646) Human Recombinant Protein
TP328130M 100 µg

SFTPA1 (NM_001164646) Human Recombinant Protein

Sign In for Pricing
View Details
GST Recombinant Rabbit monoclonal Antibody
HA750257 100 µL

GST Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Adamts3 Mouse Gene Knockout Kit (CRISPR)
KN500860 1 Kit

Adamts3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARMET (MANF) Human Gene Knockout Kit (CRISPR)
KN421555 1 Kit

ARMET (MANF) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details