Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1442 (MJ1442)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1442 (MJ1442) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1442

UniProt

Q58837

Expression Region

1-202

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSIRIFIKFYGGTMRKFLIFLIFLSVLGCGITISGCIGGKNVEEIQNMQEQVVQQQQNE NQEEYQNEDEGVDYNSIRDVQPIGTAKEADEKIRPILNEVFGEVKLMEYVSTGKQNEGES IVLTYVPKRKITTNDFEKLNEAIKKSGYFESSGGIAGGGQSGEGMVLWYVSKDNKSAIQI ILYPDTNEIVVGYYKGKIYSSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEAL1 Human shRNA Plasmid Kit (Locus ID 9338)
TL308913 1 Kit

TCEAL1 Human shRNA Plasmid Kit (Locus ID 9338)

Sign In for Pricing
View Details
Recombinant Human Torsin-1A-interacting protein 2 (TOR1AIP2)
orb2924548-01 20 µg

Recombinant Human Torsin-1A-interacting protein 2 (TOR1AIP2)

Sign In for Pricing
View Details
Recombinant Human Torsin-1A-interacting protein 2 (TOR1AIP2)
orb2924548-02 100 µg

Recombinant Human Torsin-1A-interacting protein 2 (TOR1AIP2)

Sign In for Pricing
View Details
Palladin (PALLD) (NM_001166110) Human Tagged Lenti ORF Clone
RC228528L4 10 µg

Palladin (PALLD) (NM_001166110) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
AFP Monoclonal Antibody, PE-Cy7 Conjugated
bsm-43140M-PE-Cy7 100 µL

AFP Monoclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
ARMC6 (Armadillo Repeat Containing 6, MGC19595, R30923_1)
243496 50 µL

ARMC6 (Armadillo Repeat Containing 6, MGC19595, R30923_1)

Sign In for Pricing
View Details