Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse E3 ubiquitin-protein ligase RNF152 (Rnf152)

This Recombinant Mouse E3 ubiquitin-protein ligase RNF152 (Rnf152) spans the amino acid sequence from region 1-203.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase RNF152, EC= 6.3.2.-, RING finger protein 152

UniProt

Q8BG47

Expression Region

1-203

Origin

Mus musculus (Mouse)

Field of Research

Molecular Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKL PPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERTLLPGDMGCR LLPGSQQKSLTVVTIPAEQQPLQGGAPPEAVEEEPDRRGVVKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3K9me1 antibody (pAb)
MBS388429-01 0.01 mL

Histone H3K9me1 antibody (pAb)

Sign In for Pricing
View Details
Histone H3K9me1 antibody (pAb)
MBS388429-02 0.1 mL

Histone H3K9me1 antibody (pAb)

Sign In for Pricing
View Details
Histone H3K9me1 antibody (pAb)
MBS388429-03 5x 0.1 mL

Histone H3K9me1 antibody (pAb)

Sign In for Pricing
View Details
Dicyclopentamethylenethiuram Disulfide
270800-01 1 g

Dicyclopentamethylenethiuram Disulfide

Sign In for Pricing
View Details
Dicyclopentamethylenethiuram Disulfide
270800-02 5 g

Dicyclopentamethylenethiuram Disulfide

Sign In for Pricing
View Details
Diosgenin
MBS3608687-01 50 mg

Diosgenin

Sign In for Pricing
View Details