Recombinant Sinorhizobium medicae ATP synthase subunit b/b' (atpG)
This Recombinant Sinorhizobium medicae ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-204.
Product Specifications
Product Name Alternative
ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'
UniProt
A6U6M6
Expression Region
1-204
Origin
Sinorhizobium medicae (strain WSM419) (Ensifer medicae)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFVTAAYAQSTTTEGAEAHDAAAAGEVHTETGVAHEGEHGSGVFPPFDSTHFASQLLWLA ITFGLFYLLMSKVIIPRIGSILETRHDRIAQDLDEASRLKGEADAAIAAYEQELAGARAK GHSIADTAREAAKSKAKADRDGVEADLAKKIAAAEARIGDIKSKALADVGAIAEETATAI VKQLIGGTVTKSEIAAAFKASAGN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941081-500 1x 500 µL
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC700977-500 1x 500 µL
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040983-500 1x 500 µL
CD117 (KIT/983), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741993-500 1x 500 µL
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details