Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodospirillum centenum ATP synthase subunit b' (atpG)

This Recombinant Rhodospirillum centenum ATP synthase subunit b' (atpG) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

ATP synthase subunit b', ATP synthase F (0) sector subunit b', ATPase subunit II, F-type ATPase subunit b', F-ATPase subunit b'

UniProt

B6IX46

Expression Region

1-204

Origin

Rhodospirillum centenum (strain ATCC 51521 / SW)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQEVAPPAAAQDDAHGTAEHIAEGVAAETAEHAKGGLPQLNPDTYPTQIFWLAVTFGLL LFLMSKVALPRVAEVLEARQEKIADDLDRAGALKAEADAVIENYERELAEARAKAQKVLS DATLAAESETTQRLGELAADLAERARAAEARIEQARRAALGNIRGVAAETAVAAAAKLAG LDLDPATAEAAVEEALNRVRQEVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fasinumab Biosimilar - Research Grade
ICH5152-100mg 100 mg

Fasinumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Human FAPα Antibody Pair Set
E-KAB-0425 50 µL & 100 µg

Human FAPα Antibody Pair Set

Sign In for Pricing
View Details
Desmoglein-2 Antibody
KC-27642-01 50 μL

Desmoglein-2 Antibody

Sign In for Pricing
View Details
Desmoglein-2 Antibody
KC-27642-02 100 µL

Desmoglein-2 Antibody

Sign In for Pricing
View Details
Desmoglein-2 Antibody
KC-27642-03 1 mL

Desmoglein-2 Antibody

Sign In for Pricing
View Details
Sealing Mats
DPMATR-9-BULK 100 Units/Case

Sealing Mats

Sign In for Pricing
View Details