Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colicin-A (caa)

This Recombinant Colicin-A (caa) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Colicin-A

UniProt

Q47108

Expression Region

1-204

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VAEKAKDERELLEKTSELIAGMGDKIGEHLGDKYKAIAKDIADNIKNFQGKTIRSFDDAM ASLNKITANPAMKINKADRDALVNAWKHVDAQDMANKLGNLSKAFKVADVVMKVEKVREK SIEGYETGNWGPLMLEVESWVLSGIASSVALGIFSATLGAYALSLGVPAIAVGIAGILLA AVVGALIDDKFADALNNEIIRPAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF3C1 3'UTR GFP Stable Cell Line
TU059438 1.0 mL

GTF3C1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
YBX1 (NSEP1, YB1, Nuclease-sensitive Element-binding Protein 1, CCAAT-binding Transcription Factor I Subunit A, DNA-binding Protein B, Enhancer Factor I Subunit A, Y-box Transcription Factor, Y-box-binding Protein 1, MGC104858, MGC110976, MGC117250) (AP) discontinued
135476-AP 100 µL

YBX1 (NSEP1, YB1, Nuclease-sensitive Element-binding Protein 1, CCAAT-binding Transcription Factor I Subunit A, DNA-binding Protein B, Enhancer Factor I Subunit A, Y-box Transcription Factor, Y-box-binding Protein 1, MGC104858, MGC110976, MGC117250) (AP) discontinued

Sign In for Pricing
View Details
Guinea-pig Try2 (Trypsinogen II) ValidElisa Kit
EK347632 96 Well

Guinea-pig Try2 (Trypsinogen II) ValidElisa Kit

Sign In for Pricing
View Details
AdmiRa-hsa-miR-26b-5p Virus
mh0312 250 µL

AdmiRa-hsa-miR-26b-5p Virus

Sign In for Pricing
View Details
TLL1, CT (TLL1, TLL, Tolloid-like protein 1) (MaxLight 750)
MBS6355842-01 0.1 mL

TLL1, CT (TLL1, TLL, Tolloid-like protein 1) (MaxLight 750)

Sign In for Pricing
View Details
TLL1, CT (TLL1, TLL, Tolloid-like protein 1) (MaxLight 750)
MBS6355842-02 5x 0.1 mL

TLL1, CT (TLL1, TLL, Tolloid-like protein 1) (MaxLight 750)

Sign In for Pricing
View Details