Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL61 (ATL61)

This Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL61 (ATL61) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Putative RING-H2 finger protein ATL61

UniProt

Q9LUL6

Expression Region

1-204

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKESDAVILIHLGINIVFAFFFFGISAVVVSCIIKCYNTHDDDHDHDNNNDGHVSITIKE RVGIKPYVLRSIPIVDFNTKDFKYVLECVVCLSELADGDKARVLPSCDHWFHVECIDSWL QSNSTCPICRKRVCLKQSRTRPELGGRDKSFNQNHDQTSEHHEFSTDPPTNTDTAIIEDG GCGEANEGQPELTAVVIDIPAKEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-500 1x 500 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1), CF740 conjugate, 0.1mg/mL
BNC740448-100 1x 100 µL

TTF-1 / NKX2.1 (8G7G3/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (Ki-1/779), CF740 conjugate, 0.1mg/mL
BNC740779-100 1x 100 µL

CD30 (Ki-1/779), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details