Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fusobacterium nucleatum subsp. nucleatum Membrane protein insertase YidC (yidC)

This Recombinant Fusobacterium nucleatum subsp. nucleatum Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-205.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q8RHA4

Expression Region

1-205

Origin

Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYIYNLLKQFLAFLLNTTDKYVGNFGISIIIVTILIKIILLPLTLKQDKSMKEMKKLQP ELEKIKQKYANDKQMLNIKTMELYREHKVNPLGGCLPILVQLPILFALFGVLRSGIIPAD SSFLWMRLADPDPFYVLPVLNGAVSFLQQKLMGTSDNAQMKNMMYVFPIMMIVISYRMPS GLQLYWLTSSLIAVIQQYFIMKKGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/1074), CF640R conjugate, 0.1mg/mL
BNC401017-100 1x 100 µL

SOX10 (SOX10/1074), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF594 conjugate, 0.1mg/mL
BNC941975-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details