Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter uraniireducens ATP synthase subunit b (atpF)

This Recombinant Geobacter uraniireducens ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-205.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A5G9D4

Expression Region

1-205

Origin

Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSTRKSVLTSSSTITVTTCLLLVGLAAAGYASEGGEGAHHVDTAKQMKDFAWRCLDFAV LLAIVVWALKKANVKGSLAERQSNIEKMLKEAVEAKEQAEKKFLEYNEKLEQANKEIEAM SAAMKQEGELEKVRIIAEAKAAAEKVKEQAQQAAHQEILKARIELRDEAARLAVEIAEKK IKENITKNDQDKLVGDYISKVVTLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S-Transferase Mu2 (GSTM2) (CPTC-GSTMu2-2), CF640R conjugate, 0.1mg/mL
BNC402242-100 1x 100 µL

Glutathione S-Transferase Mu2 (GSTM2) (CPTC-GSTMu2-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMAD2 Antibody
KC-6137-01 50 μL

SMAD2 Antibody

Sign In for Pricing
View Details
SMAD2 Antibody
KC-6137-02 100 µL

SMAD2 Antibody

Sign In for Pricing
View Details
SMAD2 Antibody
KC-6137-03 1 mL

SMAD2 Antibody

Sign In for Pricing
View Details
NELL2 (NM_001145110) Human Over-expression Lysate
LC428697 20 µg

NELL2 (NM_001145110) Human Over-expression Lysate

Sign In for Pricing
View Details
Apoptosis inhibitor 5 (API5) (NM_001142931) Human Over-expression Lysate
LC428299 20 µg

Apoptosis inhibitor 5 (API5) (NM_001142931) Human Over-expression Lysate

Sign In for Pricing
View Details