Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ajellomyces dermatitidis Protein GET1 (GET1)

This Recombinant Ajellomyces dermatitidis Protein GET1 (GET1) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Protein GET1, Guided entry of tail-anchored proteins 1

UniProt

C5G729

Expression Region

1-206

Origin

Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) (Blastomyces dermatitidis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSLLITILLLNIVIYVINTIGAATIDSLLWLFYIKLPTGTSHMAREQRRLKREVIQLKR EMNATSSQDEFAKWAKLRRRHDKALETYEAKNNELTQCKSSFDMTVKSVRWAATSGLMLF LQFWYSKRPIFTLPPGWIPWQVQWVLSFPRAPMGTVSIQIWGGACATVVALVGDAVGATM GFVSASKKEGMKVGAGVGEKEGKKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osteopontin (SPP1) (NM_001040058) Human Recombinant Protein
TP304803 20 µg

Osteopontin (SPP1) (NM_001040058) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human ICAM-5 Protein (Fc Tag)
PDMH100323-01 20 µg

Recombinant Human ICAM-5 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ICAM-5 Protein (Fc Tag)
PDMH100323-02 100 µg

Recombinant Human ICAM-5 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ICAM-5 Protein (Fc Tag)
PDMH100323-03 500 µg

Recombinant Human ICAM-5 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ICAM-5 Protein (Fc Tag)
PDMH100323-04 1 mg

Recombinant Human ICAM-5 Protein (Fc Tag)

Sign In for Pricing
View Details
TRAPPC2B (NR_002166) Human Recombinant Protein
TP315934M 100 µg

TRAPPC2B (NR_002166) Human Recombinant Protein

Sign In for Pricing
View Details