Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mpv17-like protein 2 (MPV17L2)

This Recombinant Human Mpv17-like protein 2 (MPV17L2) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Mpv17-like protein 2

UniProt

Q567V2

Expression Region

1-206

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPR RSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLG LGCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDT YLSYLKYRSPVPLTPPGCVALDTRAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UHRF1 Recombinant Rabbit monoclonal Antibody
HA723228 100 µL

UHRF1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS505669 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
SEMA4C (C-term) Rabbit Polyclonal Antibody
AP53847PU-N 400 µL

SEMA4C (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GFP (Ads. to Hu, Ms, Rt Serum Proteins) Chicken Polyclonal Antibody
AP09426PU-N 100 µg

GFP (Ads. to Hu, Ms, Rt Serum Proteins) Chicken Polyclonal Antibody

Sign In for Pricing
View Details
GIP Human Gene Knockout Kit (CRISPR)
KN422456 1 Kit

GIP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRM1 Human Gene Knockout Kit (CRISPR)
KN402709 1 Kit

PRM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details