Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0283731 (DDB_G0283731)

This Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0283731 (DDB_G0283731) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Uncharacterized transmembrane protein DDB_G0283731

UniProt

Q54QN4

Expression Region

1-206

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSRATRLLSTKNVVVNSIVKHTTIRSFASHGGGEAGGAYPTEPEAGTQMITRRVEFGDA VYSYKHGNFIVDPIQIRELAEEQQQQQHHVHGPGCSHGHHHDSHANDGHHDEHHDEHHDH VNPDDVEDEFPRGYFLNTPPSVPYPMNPYYLTALCLLPIIGSLFSIRYFDNKSENDYELF RSEYLEANPALKQKYYDITHKYPLSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF640R conjugate, 0.1mg/mL
BNC401856-100 1x 100 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF488A conjugate, 0.1mg/mL
BNC881788-100 1x 100 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details