Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Protein SYM1 (SYM1)

This Recombinant Debaryomyces hansenii Protein SYM1 (SYM1) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Protein SYM1

UniProt

Q6BMY0

Expression Region

1-206

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASIYQKYSQLIAKRPLITNIITTGFLFGSGDYLAQTLYPSSSKYDYKRTLRATFYGSII FAPIGDKWYRLLHKINFPFPKTKVSPTVSKVLNTLTKVGVDQLVFAPFIGIPLYYSVMSV LEFHDNPLQVAREKLHAHWFNTLKTNWVVWPTFQLFNFALIPVQFRLLVVNIFSIGWNCY LSSVLNHKHDFLIENITDVDKDEILI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taf9 Mouse Gene Knockout Kit (CRISPR)
KN517156 1 Kit

Taf9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Integrated OR lamp BOPL-305
BOPL-305 1 Unit

Integrated OR lamp BOPL-305

Sign In for Pricing
View Details
QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit
E-OSEL-M0018-01 24 Tests

QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit
E-OSEL-M0018-02 48 Tests

QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit
E-OSEL-M0018-03 96 Tests

QuicKey Pro Mouse CHEM (Chemerin) ELISA Kit

Sign In for Pricing
View Details
CPEB1 Rabbit Polyclonal Antibody
ER1902-92 100 µL

CPEB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details