Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Electron transport complex protein RnfG (rnfG)

This Recombinant Electron transport complex protein RnfG (rnfG) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfG

UniProt

Q8Z6Q7

Expression Region

1-206

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKTIRKHGITLALFAAGSTGLTAVINQMTKSTIHEQALQQQHALFDQVLPPDRYNNNLQ ESCYLVDAPALGKGTHRVFIARKDDKPVAAIIEATAPDGYSGAIQLIVGADFNGTILGTR VTEHHETPGLGDKIERRLSDWITHFSGKTISGENDTHWAVKKDGGDFDQFTGATITPRAV VNAVKRAGLYAESLPAQLPHLTACGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mono-carboxy-isooctyl Phthalate-d4
TRC-M525592-25MG 25 mg

Mono-carboxy-isooctyl Phthalate-d4

Sign In for Pricing
View Details
2-Furfurylamine
TRC-F864260-50G 50 g

2-Furfurylamine

Sign In for Pricing
View Details
CD1a (O10), CF488A conjugate, 0.1mg/mL
BNC880667-100 1x 100 µL

CD1a (O10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(1S)-[1,1'-Binaphthalene]-2,2'-diol
TRC-B387020-5G 5 g

(1S)-[1,1'-Binaphthalene]-2,2'-diol

Sign In for Pricing
View Details
Human ARGFX activation kit by CRISPRa
GA118599 1 Kit

Human ARGFX activation kit by CRISPRa

Sign In for Pricing
View Details
3-(4'-Hydroxy)phenoxybenzoic Acid
TRC-H951225-100MG 100 mg

3-(4'-Hydroxy)phenoxybenzoic Acid

Sign In for Pricing
View Details