Recombinant Myxoma virus E3 ubiquitin-protein ligase LAP (LAP)
This Recombinant Myxoma virus E3 ubiquitin-protein ligase LAP (LAP) spans the amino acid sequence from region 1-206.
Product Specifications
Product Name Alternative
E3 ubiquitin-protein ligase LAP, EC= 6.3.2.-, Leukemia associated protein, LAP
UniProt
Q997C2
Expression Region
1-206
Origin
Myxoma virus (strain Lausanne) (MYXV)
Field of Research
Infectious Disease & Virology; Molecular Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MATVVNMDTVVNLDDVSLADKCCWICKEACDIVPNYCKCRGDNKIVHKECLEEWINTDVV KNKSCAICESPYNLKRRYKKITKWRCYKRDCHDSLLVNMSLCLIVGGMGGYLLISTEIVK LIASEEVSNIAKVFLVSASMGPFMVSALTMVRACIDCRTYFIATRERNTIHEVAEMEDVE EVEEVNDDDGDEYVDAVEEIVVESPA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040204-100 1x 100 µL
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040460-500 1x 500 µL
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402748-100 1x 100 µL
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041989-100 1x 100 µL
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details