Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Stage V sporulation protein AA (spoVAA)

This Recombinant Bacillus subtilis Stage V sporulation protein AA (spoVAA) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Stage V sporulation protein AA

UniProt

P40866

Expression Region

1-206

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERRIFIRLRHRVLAHPGDIITVGDAAQIEGQLQLKKKLSAMPLYQVSEKDKNIVILDII QVLRAIHLQDPTIDVQTVGGAETIVEIQYRKRNLSTVLFIGVWLLLFIGSCLAIMNFHED VSMRDVHIALYEIITGERNDYPYLLQIPYSIGLGLGMIVFFNHIFKKRLNEEPSPLEVEM FNYQLDLDQYVAMHENQETIKDLHDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (4-Bromo-1H-pyrazol-1-yl) -6-chloropyridazine
OR11472 1 Each

3- (4-Bromo-1H-pyrazol-1-yl) -6-chloropyridazine

Sign In for Pricing
View Details
E2F-4 (RK-13) : m-IgG2a BP-HRP Bundle
sc-547027 1 Kit

E2F-4 (RK-13) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
N-SMase3 Double Nickase Plasmid (m2)
sc-429556-NIC-2 20 µg

N-SMase3 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Dicer Antibody: FITC
MBS800910-01 0.1 mg

Dicer Antibody: FITC

Sign In for Pricing
View Details
Dicer Antibody: FITC
MBS800910-02 5x 0.1 mg

Dicer Antibody: FITC

Sign In for Pricing
View Details
BMP7 mouse polyclonal antibody
MO15079-500 500 µg

BMP7 mouse polyclonal antibody

Sign In for Pricing
View Details