Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthobacter autotrophicus ATP synthase subunit b 2 (atpF2)

This Recombinant Xanthobacter autotrophicus ATP synthase subunit b 2 (atpF2) spans the amino acid sequence from region 1-207.

Product Specifications

Product Name Alternative

ATP synthase subunit b 2, ATP synthase F (0) sector subunit b 2, ATPase subunit I 2, F-type ATPase subunit b 2, F-ATPase subunit b 2

UniProt

A7IGS8

Expression Region

1-207

Origin

Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVAQAAPPAGTAGQGTHEAASAAHGAAAAHGAAEEGHGKKSHFPPFDATTFASQLLWLVL SFGLLYLLMSRVALPRIGRILEERHDRIADDLEEAAKHKAESEAAQASYEKALAEARAKA NAIAGETRNRLAADSEANRKSLEAGLAVKLATAEQSIASTKTEALTHVRGIAVDATHAIV STLIGSSPAQSDVEKAVDVALVKKDAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Glucosidase 2 subunit beta
MBS9421636-01 0.02 mg

Recombinant Human Glucosidase 2 subunit beta

Sign In for Pricing
View Details
Recombinant Human Glucosidase 2 subunit beta
MBS9421636-02 0.1 mg

Recombinant Human Glucosidase 2 subunit beta

Sign In for Pricing
View Details
Recombinant Human Glucosidase 2 subunit beta
MBS9421636-03 1 mg

Recombinant Human Glucosidase 2 subunit beta

Sign In for Pricing
View Details
Recombinant Human Glucosidase 2 subunit beta
MBS9421636-04 5x 1 mg

Recombinant Human Glucosidase 2 subunit beta

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Thiosulfate Sulfurtransferase (TST)
MBS2068348-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Thiosulfate Sulfurtransferase (TST)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Thiosulfate Sulfurtransferase (TST)
MBS2068348-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Thiosulfate Sulfurtransferase (TST)

Sign In for Pricing
View Details