Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM22 (TIM22)
This Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM22 (TIM22) spans the amino acid sequence from region 1-207.
Product Specifications
Product Name Alternative
Mitochondrial import inner membrane translocase subunit TIM22
UniProt
Q12328
Expression Region
1-207
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVYTGFGLEQISPAQKKPYNELTPEEQGERGAEMIMNFMTSCPGKSVVSGVTGFALGGVL GLFMASMAYDTPLHTPTPANTAATATAGNIGVGGISRTVQQISDLPFRQQMKLQFTDMGK KSYSSAKNFGYIGMIYAGVECVIESLRAKNDIYNGVTAGFFTGAGLAYKAGPQAALMGGA GFAAFSAAIDLYMKSEDGRPPQNDFKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 