Recombinant Rhizobium etli ATP synthase subunit b/b' (atpG)
This Recombinant Rhizobium etli ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-207.
Product Specifications
Product Name Alternative
ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'
UniProt
Q2KBV9
Expression Region
1-207
Origin
Rhizobium etli (strain CFN 42 / ATCC 51251)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGPFPPFDSTTYASQLLW LVITFGVFYLLMQKVIAPRIGAILDQRHKRISQDLEEAGRLKAEADAAVQTYEGELAAAR AKSHAIGSAARDAAKVKAEEDRRTVEASLSEKIKAAEARIADIKAKAFADVGTIAEETAA AVVEQLIGSTAAQADVAAAVAAAKKEV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
317690-01 50 µL
GORASP1 (Golgi Reassembly-stacking Protein 1, Golgi Peripheral Membrane Protein p65, Golgi Phosphoprotein 5, GOLPH5, Golgi Reassembly-stacking Protein of 65kD, GOLPH5, GRASP65)
Sign In for Pricing
View Details 317690-02 100 µL
GORASP1 (Golgi Reassembly-stacking Protein 1, Golgi Peripheral Membrane Protein p65, Golgi Phosphoprotein 5, GOLPH5, Golgi Reassembly-stacking Protein of 65kD, GOLPH5, GRASP65)
Sign In for Pricing
View Details 