Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter arcticus NADH-quinone oxidoreductase subunit A (nuoA)

This Recombinant Psychrobacter arcticus NADH-quinone oxidoreductase subunit A (nuoA) spans the amino acid sequence from region 1-207.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit A, EC= 1.6.99.5, NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1

UniProt

Q4FU64

Expression Region

1-207

Origin

Psychrobacter arcticus (strain DSM 17307 / 273-4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAFNWSAIAFILAAIALVVFMLVVPRLLGGRSHGSQKEEIFEAGVVGSGNARIRLSAKF YLVAIFFVIFDLEALYLYAYAVSVREAGWLGFAAAAIFITILIIGLVYELSLGAMNWAPA DKLRKKARLYAAPAGFSLADITKFDGVDELMVDPTGKIPAQSSGQINVSNNIETNRRHLQ NIDHINTTGNVTSVDFATSAQTDNIKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-500 1x 500 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-100 1x 100 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
BNC040630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details