Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella canis ATP synthase subunit b 1 (atpF1)

This Recombinant Brucella canis ATP synthase subunit b 1 (atpF1) spans the amino acid sequence from region 1-208.

Product Specifications

Product Name Alternative

ATP synthase subunit b 1, ATP synthase F (0) sector subunit b 1, ATPase subunit I 1, F-type ATPase subunit b 1, F-ATPase subunit b 1

UniProt

A9M8G0

Expression Region

1-208

Origin

Brucella canis (strain ATCC 23365 / NCTC 10854)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSGVFPPFDSTHYASQVLW LAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQAR SKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEETTA TIVEQLLGLTADKASVSEAVKAIRASNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NEXN Antibody
RN-12213-01 50 μL

Recombinant NEXN Antibody

Sign In for Pricing
View Details
Recombinant NEXN Antibody
RN-12213-02 100 µL

Recombinant NEXN Antibody

Sign In for Pricing
View Details
Recombinant NEXN Antibody
RN-12213-03 1 mL

Recombinant NEXN Antibody

Sign In for Pricing
View Details
(S)-1-Boc-3-hydroxypiperidine-d4
TRC-B656652-25MG 25 mg

(S)-1-Boc-3-hydroxypiperidine-d4

Sign In for Pricing
View Details
Frataxin (Mitochondrial Marker) (rFXN/2124), CF568 conjugate, 0.1mg/mL
BNC683794-100 1x 100 µL

Frataxin (Mitochondrial Marker) (rFXN/2124), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benzyl 4-Nitrophenyl Carbonate
TRC-B285485-5G 5 g

Benzyl 4-Nitrophenyl Carbonate

Sign In for Pricing
View Details