Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 199 (Tmem199)

This Recombinant Mouse Transmembrane protein 199 (Tmem199) spans the amino acid sequence from region 1-208.

Product Specifications

Product Name Alternative

Transmembrane protein 199

UniProt

Q5SYH2

Expression Region

1-208

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASSLLAGERLVRALGPGGELEREQLPRKLRAQLEAALGKKHAGSDNATGPRRLVSFRLI RDLHQHLRERNSRLYLHELLEGSDIYFPEIVKPPRNPELVARLEKIKIQLANEEYKRITR NVTCQDAQCGGTLSDLGKQVRSVKALVVTIFNFIITVAAAFVCTYLGSQYVFTEMASRVL AALIVASVVGLAELYVMVRAMEGELGEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: rectosigmoid
CS509086 5x 5 µm

Frozen Tissue Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
Recombinant CD97 Antibody
RC-16049-01 50 μL

Recombinant CD97 Antibody

Sign In for Pricing
View Details
Recombinant CD97 Antibody
RC-16049-02 100 µL

Recombinant CD97 Antibody

Sign In for Pricing
View Details
Recombinant CD97 Antibody
RC-16049-03 1 mL

Recombinant CD97 Antibody

Sign In for Pricing
View Details
ZNF675 Human Gene Knockout Kit (CRISPR)
KN414834 1 Kit

ZNF675 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FAM167A activation kit by CRISPRa
GA113224 1 Kit

Human FAM167A activation kit by CRISPRa

Sign In for Pricing
View Details