Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus ATP synthase subunit b 1 (atpF1)

This Recombinant Brucella abortus ATP synthase subunit b 1 (atpF1) spans the amino acid sequence from region 1-208.

Product Specifications

Product Name Alternative

ATP synthase subunit b 1, ATP synthase F (0) sector subunit b 1, ATPase subunit I 1, F-type ATPase subunit b 1, F-ATPase subunit b 1

UniProt

Q2YMC5

Expression Region

1-208

Origin

Brucella abortus (strain 2308)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSGVFPPFDSTHYASQVLW LAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQAR SKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEETTA TIVEQLLGLTADKASVSEAVKAIRASNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MRPS21 knockout cell line
ABC-KH9517 1 Vial

Human MRPS21 knockout cell line

Sign In for Pricing
View Details
Lentiviral human RNF24 shRNA (UAS) - Lentiviral human RNF24 shRNA (UAS, RFP) plasmid
GTR15099565 1 Vial

Lentiviral human RNF24 shRNA (UAS) - Lentiviral human RNF24 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit Anti-Human NDUFS7 pAb
PA16094-01 50 μL

Rabbit Anti-Human NDUFS7 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human NDUFS7 pAb
PA16094-02 100 μL

Rabbit Anti-Human NDUFS7 pAb

Sign In for Pricing
View Details
Fusion Mixture
097425 500 g

Fusion Mixture

Sign In for Pricing
View Details
ARF3 Rabbit Polyclonal Antibody (FITC)
orb465615 100 µL

ARF3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details