Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis UPF0316 protein SERP1448 (SERP1448)

This Recombinant Staphylococcus epidermidis UPF0316 protein SERP1448 (SERP1448) spans the amino acid sequence from region 1-208.

Product Specifications

Product Name Alternative

UPF0316 protein SERP1448

UniProt

Q5HN24

Expression Region

1-208

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAIAQNPWLMVLAIFIINVCYVTFLTMRTILTLKGYRYVAAVVSFMEVLVYVVGLGLVM SSLDQIQNIFAYALGFSVGIIVGMKIEEKLALGYTVVNVTSSEYELDLPNELRNLGYGVT HYEAFGRDGSRMVMQILTPRKYELKLMDTVKNLDPKAFIIAYEPRNIHGGFWVKGVRKRK LKAYEPEQLEVVVDHEEIVGGSSNEQKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NACA (NM_001113202) AAV Particle
RC225257A1V 250 µL

Human NACA (NM_001113202) AAV Particle

Sign In for Pricing
View Details
IgY, Heavy Chain (MaxLight 550)
MBS6255021-01 0.1 mL

IgY, Heavy Chain (MaxLight 550)

Sign In for Pricing
View Details
IgY, Heavy Chain (MaxLight 550)
MBS6255021-02 5x 0.1 mL

IgY, Heavy Chain (MaxLight 550)

Sign In for Pricing
View Details
Ctsa Rat shRNA Plasmid (Locus ID 296370)
TL701472 1 Kit

Ctsa Rat shRNA Plasmid (Locus ID 296370)

Sign In for Pricing
View Details
Ppdpf ORF Vector (Mouse) (pORF)
37308014 1.0 µg DNA

Ppdpf ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CD105 (Endoglin) (Biotin) discontinued
214570-Biotin 100 µL

CD105 (Endoglin) (Biotin) discontinued

Sign In for Pricing
View Details