Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum Electron transport complex protein RnfG (rnfG)

This Recombinant Pectobacterium carotovorum subsp. carotovorum Electron transport complex protein RnfG (rnfG) spans the amino acid sequence from region 1-209.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfG

UniProt

C6DH13

Expression Region

1-209

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITTMRRHATTLALFAAFTTAVTAVVNMLTEPTISHQAMLQQKMLLDQVVPAELYNSDMQ KECYVVTNPALGSSAPHRVFIARQDGEPVAAALESTAPDGYSGAIRLLVGADFHGKVLGV RVTEHHETPGLGDKIEVRISDWITRFSGQTVQSEQDARWAVKKEGGMFDQFTGATITPRA VINSVKRSALYLQTLPSQINTLSACGENQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-100 1x 100 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1961), CF568 conjugate, 0.1mg/mL
BNC681961-100 1x 100 µL

Tryptase (Mast Cell Marker) (TPSAB1/1961), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF647 conjugate, 0.1mg/mL
BNC471948-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details