Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erwinia carotovora subsp. atroseptica Electron transport complex protein RnfG (rnfG)

This Recombinant Erwinia carotovora subsp. atroseptica Electron transport complex protein RnfG (rnfG) spans the amino acid sequence from region 1-209.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfG, Nitrogen fixation protein RnfG

UniProt

Q6D4W0

Expression Region

1-209

Origin

Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMTTMRRHATTLALFAASTTAVTAVVNMLTEPTISHQAMLQQKMLLDQVVPAELYNSDIQ KECYVVTNPALGSSAPHRVFIARQNGEPVAAALESTAPDGYSGAIRLLVGADFHGKVLGV RVTEHHETPGLGDKIEVRISDWITRFNGLMVQGEHDARWAVKKEGGMFDQFTGATITPRA VINSVKRSALYLQTLPPQINTLSACGENQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-100 1x 100 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF405S conjugate, 0.1mg/mL
BNC042007-100 1x 100 µL

MHC II, Mouse (MK-D6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details