Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable glutathione peroxidase 8 (Gpx8)

This Recombinant Mouse Probable glutathione peroxidase 8 (Gpx8) spans the amino acid sequence from region 1-209.

Product Specifications

Product Name Alternative

Probable glutathione peroxidase 8, GPx-8, GSHPx-8, EC= 1.11.1.9

UniProt

Q9D7B7

Expression Region

1-209

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPFAAYPLKCSGPKAKIFAVLLSMVLCTVMLFLLQLKFLKPRTNSFYSFEVKDAKGRTV SLEKFKGKASLVVNVASDCRFTDKSYQTLRELHKEFGPYHFNVLAFPCNQFGESEPKSSK EVESFARQNYGVTFPIFHKIKILGPEAEPAFRFIVDSSKKEPRWNFWKYLVNPEGQVVKF WRPEEPLEAIRPHVSQMIGQIILKKKEDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-100 1x 100 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-500 1x 500 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-500 1x 500 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-100 1x 100 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF640R conjugate, 0.1mg/mL
BNC401700-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details